PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.16G182400.2.p
Common NameGLYMA_16G182400, LOC100797708
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Nin-like
Protein Properties Length: 883aa    MW: 97637 Da    PI: 7.0362
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.16G182400.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK89.72.3e-28471520352
               RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                           +isl++l++yF +++kdAAk+Lgvc+T++KriCRq+GI+RWP+Rkik++
  Glyma.16G182400.2.p 471 ISISLNVLQHYFTGSLKDAAKSLGVCPTTMKRICRQHGISRWPSRKIKKV 520
                          589*********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.642457540IPR003035RWP-RK domain
PfamPF020425.6E-25473520IPR003035RWP-RK domain
SuperFamilySSF542771.05E-21781867No hitNo description
Gene3DG3DSA:3.10.20.2401.2E-25782863No hitNo description
PROSITE profilePS5174523.082782864IPR000270PB1 domain
SMARTSM006661.1E-24782864IPR000270PB1 domain
PfamPF005643.2E-18783863IPR000270PB1 domain
CDDcd064072.16E-34783863No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 883 aa     Download sequence    Send to blast
MTASENPDGY CLIKERMTQA LRHFKELTEQ NVLAQVWAPV RNGNRYALTT SGQPFVLDPH  60
SNGLHQYRTA SLMYMFSVDG ENDEILGLPG RVFQHKIPEW TPNVQFYSSK EYQRLNHAQH  120
YNVRGTLALP VFELAGQSCV AVVELIMTSQ KINYAPEVDK ICKALEAVKL RSSEILEHPY  180
NQICNEYRQY ALAEILEILT AVCETHSLPL AQTWVPCKHR SVLAHGGGLK KICSSFNGCC  240
MGQVCMSITE VAFYVIDAHK WGFHEACAEH HLQQGQGVAG RAFLSHNMCF CGNNTQFCKT  300
EYPLVHYALM FHLNSCFAVC LQSSHTGNDD YVLEFFLPPG ITDFNEQKRL LGSILATMKP  360
HFQSLKIASG VELEGNASIE IIDARNERVH LRFESIPITQ SSKSPPRHTS PNMGEGLPLE  420
PSEPKIMAYF DGINDGGSLG DNAGGHIDQN TSLEIKTKKK PSDRKRGKAE ISISLNVLQH  480
YFTGSLKDAA KSLGVCPTTM KRICRQHGIS RWPSRKIKKV NHSLSKLKCV IESVHGAEGA  540
FGLNSLSTGS LPIAAGSFSD PFTSNKFHRQ TTLTIRPSEP KINENDFDAF GASETKRQVA  600
MEDQFLGLEA RTRSPEKVIN DKGVSIQEIG TKGTNKFRTG SGSSGSGNPT HASCHGSPPN  660
EISPPKDTFV TGNSEQCLVL RGSLGSTTLH STSTPNRATA YPMLHIVETT EPQEPFGGQL  720
LEVAGSSKDL RNLCPSADAV LEDQVPEAYK MNPQCSDLPQ MQHMDTLNKT MTPFAVRKEV  780
NSVTIKATYK EDIIRFKVSM DCGIVELKEE IAKRLKLEVG TFHNKYLDDD HEWVLIACDA  840
DLQECMDISR SSGGNIIRLV VHDILPILGS SCESSRDWKG CI*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.617630.0leaf| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150440.0AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014624671.10.0PREDICTED: protein NLP7-like isoform X2
SwissprotQ84TH90.0NLP7_ARATH; Protein NLP7
TrEMBLA0A0R0G3220.0A0A0R0G322_SOYBN; Uncharacterized protein
STRINGGLYMA16G30180.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.10.0NIN like protein 7